PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA39327
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family MYB
Protein Properties Length: 302aa    MW: 34449.9 Da    PI: 6.3096
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA39327genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.41.9e-191461148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g+W++eEd++lvd ++++G g+W++ ++  g++R++k+c++rw++yl
  Tp57577_TGAC_v2_mRNA39327 14 KGPWSPEEDKILVDHIQKHGHGSWRALPKLAGLNRCGKSCRLRWNNYL 61
                               79*********************************************7 PP

2Myb_DNA-binding569.2e-1867112148
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                rg+++ eE++l+++++  lG++ W++Ia +++ gRt++++k++w+++l
  Tp57577_TGAC_v2_mRNA39327  67 RGKFSDEEEQLIINLHSVLGNK-WASIATHLP-GRTDNEIKNFWNTHL 112
                                89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.583961IPR017930Myb domain
SuperFamilySSF466892.88E-3111108IPR009057Homeodomain-like
SMARTSM007171.2E-151363IPR001005SANT/Myb domain
PfamPF002497.7E-181461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-241568IPR009057Homeodomain-like
CDDcd001675.02E-121661No hitNo description
PROSITE profilePS5129427.9762116IPR017930Myb domain
SMARTSM007171.4E-1666114IPR001005SANT/Myb domain
PfamPF002491.7E-1667112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.1E-2769117IPR009057Homeodomain-like
CDDcd001673.17E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MMRTPSNDES GLKKGPWSPE EDKILVDHIQ KHGHGSWRAL PKLAGLNRCG KSCRLRWNNY  60
LRPDIRRGKF SDEEEQLIIN LHSVLGNKWA SIATHLPGRT DNEIKNFWNT HLKKKLMQMG  120
LDPVTHRPRT DHLDLLSNLQ QIILNAANIV SNCDINNALR LQYSLLPQSL VNGVLGFNNN  180
IQNFYDGSNI GISSQIIQPN LQNFEAPLQQ FLPQECDEYT QKFDEQIGNT NVDSAISTNL  240
LPKLVSISPQ RLATVKVREE NMMINEKECC NTSSTSFETW GDFMNEDAND AYWKDIIEQQ  300
Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-291211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1267920.0AC126792.15 Medicago truncatula clone mth2-8o8, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003610818.20.0myb transcription factor
TrEMBLG7K5570.0G7K557_MEDTR; Myb transcription factor
STRINGGLYMA01G44370.21e-122(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02940.11e-91myb domain protein 107